your best answer would be the interior and the sun
Answer:
Ty and ty
Explanation:
This corn plant is being observed based on two traits controlled by two different genes (t and y). According to Mendel's law of independent assortment, the alleles of each gene of this corn plant will undergo segregation into gametes independently of one another. Hence, four possible combinations of gametes (present in the pollen) will be produced by this corn plant since it involves two traits/characters i.e. 2^n which n is the number of traits 2^2=4.
Hence, the four possible combinations of gametes that can be produced by a corn plant with Ttyy genotype is Ty, Ty, ty and ty.
Ty and ty are the only two distinct combinations
Plants growing towards air that has higher humidity levels are examples of _____.
Hydrotrophism
The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.
An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:
A Chain (21 amino acids):
GIVEQCCTSICSLYQLENYCN
B Chain (30 amino acids):
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).
Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.
Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.
Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.
Learn more about amino acids:
Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.
The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.
The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.
Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.
#SPJ11
Answer:
endless cycle of hell
Explanation:
Answer:
life without death is like not having a life at all. you need to die to have been living.
B) osteoclasts
C) osteoblasts.
D) osteocytes.
E) osteogenic cells
Answer:
Osteoclasts.
Explanation:
Osteoclasts may be defined as the cells that helps in the breakdown of the bone tissue. Osteoclast plays an important role in the maintenance of the bone structure.
Osteoclasts cells are found in the small depression of the endosoteal surface. This is also known as Howship's lacunae. They shows the foamy appearance in the cell. The osteoclast can form the specialized cell membrane known as ruffle border.
Thus, the correct answer is option (B).