All of the energy that drives Earth's rock cycle comes from

Answers

Answer 1
Answer: Ultimately, all energy is from the Sun, but the core holds the mantle which Earth stores the energy.
Answer 2
Answer:

your best answer would be the interior and the sun


Related Questions

You might find _____ in the Arctic.
The scales of female pine cones produce a sticky substance. what function might this serve?
What are the pros and cons of AREAIL WOLF HUNTING?
Scientific theories, such as the theory of evolution, must beA- neither testable nor observable B- testable and observable C- observable D- testable
Both plants and fungi have cell walls made up of cellulose. a. True b. False

If a corn plant has a genotype of Ttyy, what are the possible genetic combinations that could be present in a single grain of pollen from this plant

Answers

Answer:

Ty and ty

Explanation:

This corn plant is being observed based on two traits controlled by two different genes (t and y). According to Mendel's law of independent assortment, the alleles of each gene of this corn plant will undergo segregation into gametes independently of one another. Hence, four possible combinations of gametes (present in the pollen) will be produced by this corn plant since it involves two traits/characters i.e. 2^n which n is the number of traits 2^2=4.

Hence, the four possible combinations of gametes that can be produced by a corn plant with Ttyy genotype is Ty, Ty, ty and ty.

Ty and ty are the only two distinct combinations

The two combinations possible are Ty and ty. The allele Y doesn't exist in it's genotype, it cannot pass on the dominant allele Y, because it can't pass on what it doesn't have.

Plants growing towards air that has higher humidity levels are examples of _____. phototrophism geotrophism thigmotrophism hydrotrophism

Answers

D, hydrotrophism.
the word gives the answer away because Hydro is a word meaning water 

Plants growing towards air that has higher humidity levels are examples of _____.


Hydrotrophism

Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11

What is life without death?

Answers

Answer:

endless cycle of hell

Explanation:

Answer:

life without death is like not having a life at all. you need to die to have been living.

Cells that are found in small depressions on the endosteal surfaces are theA) osteolytic cells.
B) osteoclasts
C) osteoblasts.
D) osteocytes.
E) osteogenic cells

Answers

Answer:

Osteoclasts.

Explanation:

Osteoclasts may be defined as the cells  that helps in the breakdown of the bone tissue. Osteoclast plays an important role in the maintenance of the bone structure.

Osteoclasts cells are found in the small depression of the endosoteal surface. This is also known as  Howship's lacunae. They shows the foamy appearance in the cell. The osteoclast can form the specialized cell membrane known as ruffle border.

Thus, the correct answer is option (B).

explain why you cannot draw a conclusion about the effect of one variable in an investigation when the other key variables are not controlled

Answers

The variables that aren't controlled can effect the results as well as the variable you are controlling. With more that one key variable changing, you cannot draw a conclusion about the effects of any of them.