The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.
An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:
A Chain (21 amino acids):
GIVEQCCTSICSLYQLENYCN
B Chain (30 amino acids):
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).
Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.
Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.
Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.
Learn more about amino acids:
Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.
The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.
The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.
Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.
#SPJ11
B. 50%.
C. 75%.
D. 25%.
A 100% is the correct answer
particles in new rocks
liquid magma
materials dissolved in solutions
Most sedimentary rocks are formed in a process that involves water. It is one of the primary factors in the mineral formation of chemical sedimentary rock. Thus, option D is correct.
Mineral crusts are formed on the sedimentary grains as a result of dissolved minerals in groundwater precipitating (crystallizing) from water in the pore spaces and eventually cementing the sediments to create a rock.
Chemical sedimentary rocks are created when minerals precipitate from water. When dissolved substances leave water, it precipitates. Take a glass of water and add some salt (halite), for instance.
Additionally, it acts as an erosive and weathering agent, generating the grains that eventually form detrital sedimentary rock.
Therefore, materials dissolved in solutions is one source of the sediments that form sedimentary rocks.
Learn more about sedimentary rocks here:
#SPJ6
Answer:
D - materials dissolved in solutions
Explanation:
EDGE 2021
Answer:
The Spiracles is/are used for gaseous exchange in insects.
Explanation:
The Spiracles is a respiratory structure or an opening found on the exoskeleton of insects. It acts as a medium of gaseous exchange not only for Insects (Insecta) but also for some Arachnid (spiders and others).
limitations due to the system being too large to investigate thoroughly
limitations due to high expenses for equipment and supplies
limitations due to ethical concerns about experimental subjects
Answer:
d
Explanation: