Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

Answer 1
Answer:

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Answer 2
Answer:

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11


Related Questions

Two tectonic plates under water move apart, and magma fills the space between them this is an example of
The taking of a sediment to a new location is called?
There aren't many animals at the top of the trophic levels
The wicked witch and the big bad wolf are examples of A. anecdotes.B. dynamic characters.C. protagonists.D. archetypes.
A tall pea plant could _______. Select one: a. have the phenotype of Tt b. have the genotype of tall c. have the phenotype of tt d. have the genotype of Tt

Many new groups of organisms evolved in a relatively short time in an event called the _____.

Answers

It is called the cambrian explosion. It is where new groups of organisms arises and are being classified and it is during the period of the cambrian, one of the reason why it was named after it. It has the highest animals found during that time and it could be found on the fossil records that has been established.

What part of the cell contains genetic material?

Answers

The chromosomes contain the genetic material which are located in the nucleus 

A homozygous tall (dominant) pea plant is crossed with a short (recessive) plant. The probability that an F1 plant will be tall isA. 100%.

B. 50%.

C. 75%.

D. 25%.

Answers

The answer is A. 100%

A 100% is the correct answer

Which is one source of the sediments that form sedimentary rocks?chunks of coal
particles in new rocks
liquid magma
materials dissolved in solutions

Answers

Most sedimentary rocks are formed in a process that involves water. It is one of the primary factors in the mineral formation of chemical sedimentary rock. Thus, option D is correct.

What role of dissolved materials in the sedimentary rocks?

Mineral crusts are formed on the sedimentary grains as a result of dissolved minerals in groundwater precipitating (crystallizing) from water in the pore spaces and eventually cementing the sediments to create a rock.

Chemical sedimentary rocks are created when minerals precipitate from water. When dissolved substances leave water, it precipitates. Take a glass of water and add some salt (halite), for instance.

Additionally, it acts as an erosive and weathering agent, generating the grains that eventually form detrital sedimentary rock.

Therefore, materials dissolved in solutions is one source of the sediments that form sedimentary rocks.

Learn more about sedimentary rocks here:

brainly.com/question/10709497

#SPJ6

Answer:

D - materials dissolved in solutions

Explanation:

EDGE 2021

Gaseous exchange in an insect​

Answers

Answer:

The Spiracles is/are used for gaseous exchange in insects.

Explanation:

The Spiracles is a respiratory structure or an opening found on the exoskeleton of insects. It acts as a medium of gaseous exchange not only for Insects (Insecta) but also for some Arachnid (spiders and others).

A scientist wants to prove that certain chemicals in cosmetics are likely to cause harm to developing fetuses, when used by a pregnant mother. What is the most likely limitation she will face in her scientific design?limitations due to the time required to complete the experiment

limitations due to the system being too large to investigate thoroughly

limitations due to high expenses for equipment and supplies

limitations due to ethical concerns about experimental subjects

Answers

The answer is limitations due to ethical concerns about experimental subjects. Because the certain chemicals still need to be proved whether it is harmful. So they can not ensure the safety of the fetuses of this pregnant mother.

Answer:

d

Explanation: