BIOLOGY HIGH SCHOOL

What term means removing the nucleus from a cell?

Answers

Answer 1

Answer:

Answer:

enucleation

Explanation:

i got it right

Answer 2

Answer: lyse: to expel the nuclei from the cell

Related Questions

Why are frogs said to have 2 lives
Hemophilia is an X-linked recessive condition in which blood does not clot properly. Queen Victoria of England had one allele for hemophilia. Most of her male descendants had the disorder, but few females had it.Why did hemophilia occur more frequently in Queen Victoria’s male descendants?
A mutationAis a person or an animal randomly selected from the population.Bis a random change in a cell's DNA.Calways occurs when the male's sperm joins the female's egg.Dis produced by mating two different species.
Birds migrate great distances each year and the primary cue for migration are changes in day length. These changes in day length in turn trigger ___________ changes in the birds. Behavior and body changes follow as the birds prepare for their seasonal migrations.A) genetic B) hormonal C) physical D) reproductive
_____________fats, such as olive oil and sesame oil, are produced in plants and are liquid at room temperature.

Two species of flies, Drosophila melanogaster and Drosophila simulans, can mate. They usually do not mate, however, even if they are kept together in a laboratory. Males court the females of both species, but the females prefer to mate with males of their own species. Which isolating mechanism does this describe?A.)behavioral
B.)temporal
C.)geographical
D.)anatomical

Answers

A reproductive isolation mechanism in which females prefer to mate with males of their own species is a BEHAVIORAL mechanism.

Reproductive isolation refers to the mechanisms that prevent a species from mating with others, which have fundamental importance from an evolutionary point of view.

These barriers to fertilization can be divided into:

prezygotic isolation barriers, which prevent the fertilization of the egg
postzygotic isolation barriers, which prevent the generation of fertile offspring.

The most important prezygotic isolation barriers include, among others, habitat isolation, behavioral isolation, mechanical isolation, etc.

Behavioral isolation mechanisms are characterized by mating rituals (for example, the songs of males in certain bird species), which are capable of generating reproductive barriers.

In conclusion, a reproductive isolation mechanism in which females prefer to mate with males of their own species is a BEHAVIORAL mechanism.

Learn more in:

brainly.com/question/1162611

The isolating mechanism involved is the behavioral change (A).

Further Explanation:

Isolating mechanism are those characteristics of the species that prevents them to reproduce with other members of the species.

There are various types of isolating mechanism:

1. Behavioral- Reproductive isolation that arises due to the behavior of the individual during their mating period.

2. Temporal- The species breeds at different time or they may have different breeding season, therefore this can lead to reproductive isolation.

3. Geographical- The isolation of species because they occupies different habitats.

4. Anatomical- Isolation that arises due to different internal structure of the species.

Example of isolating mechanism - when two species of flies, Drosophila melanogaster and Drosophila simulans, can mate however they usually do not mate. But even though they are kept with each other in any lab, males court the females of both species but the females prefers to mate with males that belongs to the same species.This example shows the behavioral isolation.

Learn more:

1. Learn more about plants: brainly.com/question/862697

2. Learn more about bacteria: brainly.com/question/4656094

3. Learn more about viruses: brainly.com/question/3889603

Answer Details:

Grade: College Biology

Subject: Biology

Chapter: Ecology

Keywords:

Reproductive isolation, behavioral isolation, temporal isolation, geographical isolation, anatomical isolation, Drosophila melanogaster,Drosophila simulans, species, mate, isolating mechanism, breeding season.

In Poe's "The Cask of Amontillado Amontillado", which of the following makes Montresor an unreliable narrator?Answer choices:
A. he is part of a secret association
B. He makes exaggerated claims about Fortunato
C. he does not offer any possible reason for wanting to murder Fortunato

Answers

In Poe's "The Cask of Amontillado Amontillado" the reason that Montresor is an unreliable narrator is that he does not offer any possible reason for wanting to murder Fortunato. The correct answer is C.

the correct answer is that he makes exaggerated claims about fotunato

Which of the letters represents an interneuron? A B C D

Answers

Interneurons are those neurons that transduces the vague information received from the afferent neurons and sends a response to the efferent neurons.

Neurons are the basic unit of the nervous system. Hence, these nerve cells are the cells that transmits electrical impulses that causes a person to respond, move and irritable (respond to stimuli).

A snake that eats a mouse is an exampe of

Answers

A snake that eats a mouse is an example of predation.

In predation, there are usually two roles that are exhibited which are the predator and the prey. The predator is the organism that hunts and eats the prey and the prey is the organism that is being eaten by the predator as food. In this case, the predator would be the snake and the mouse would be the prey. This example is a commonly used to demonstrate such. This become even more complicated when the food chain is introduced or a sequence of predation where in a predator also becomes a prey and a prey was once a predator.

Final answer:

A snake eating a mouse is an example of predation in biology.

Explanation:

A snake that eats a mouse is an example of predation in biology. Predation is the act of one organism (the predator) killing and consuming another organism (the prey). Snakes are carnivorous and rely on predation to obtain their food. This relationship is a fundamental aspect of the natural world and plays an important role in ecological dynamics.

Thus, it is an interaction in which one organism, known as the predator, hunts, captures, and consumes another organism, called the prey. It is a crucial ecological process that regulates populations, influences species dynamics, and contributes to biodiversity. Predation shapes ecosystems by controlling herbivore populations and affecting prey behavior and adaptations.

Learn more about Predation here:

brainly.com/question/34900104

#SPJ6

Before the Ordovician-Silurian extinction, the diversity of life on Earth was growing enormously due to _____.shallow, warm, continental seas
cold, glaciated oceans
unknown reasons
comets hitting the earth

Answers

The answer is shallow, warm, continental seas.

The Ordovician-Silurian extinction happened about 450-430 million years ago. Before the extinction, most multicellular organisms lived in the seas. It was a rich life in shallow, warm, and continental seas. The climate was favorable. Reef-forming corals, as well as the first true vertebrates, some fish, appeared. Trilobites and mollusks were diverse and rich. Green algae were common in the seas.

Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11

Other Questions

State one biological advantage this method of reproduction has over cloning

How does the nicotine from cigarette smoking disrupt oxygen distribution to the cells? >It restricts air flow through the bronchi. >It reduces the surface area of alveolar sacs. >It binds to hemoglobin in red blood cells. >It affects the nerve signals that regulate breathing.

Why did Hershey and Chase label the viral DNA with radioactive phosphorous and not radioactive sulfur? a. DNA contains phosphorus and no sulfur. b. Proteins contain phosphorus and no sulfur. c. DNA contains sulfur and little phosphorus. d. Proteins contain sulfur and little phosphorus.

In an ocean ecosystem, which is necessary to begin a food web