When is now-casting used?15 days from now
Severe Weather Events
Clear Sky Days
Sunny Days

Answers

Answer 1
Answer:

Now-casting is most commonly used during severe weather events to provide up-to-date information and warnings.

Now-casting is a type of short-term weather forecasting that focuses on the current and immediate future weather conditions, typically up to a few hours or a few days ahead. It is used to provide real-time updates and predictions for weather events that are occurring or expected to occur in the near term.

Now-casting is commonly employed during severe weather events such as thunderstorms, hurricanes, tornadoes, or heavy rainfall. It helps meteorologists monitor the current conditions, track the progression of the weather system, and issue timely warnings or advisories to the public.

While it may also be employed during clear sky days and sunny days, its focus is primarily on dynamic weather situations and short-term forecasts rather than stable weather patterns.

Therefore, now-casting is most commonly used during severe weather events to provide up-to-date information and warnings.

For more details regarding weather forecasting, visit:

brainly.com/question/12069534

#SPJ6

Answer 2
Answer:

Answer:

Severe Weather Events

Explanation:

JUST TOOK THE QUIZ


Related Questions

The peritoneum is the most extensive serous membrane in the body. true false
Darwin hypothesized that there are definite steps to natural selection. Consider the model here. Use the Roman numerals (I - III) to guide you through the steps. Which is an accurate description of Darwin's hypothesized theory of natural selection? A) Sexual reproduction of bacteria cause variation. Some bacteria survive and some do not. Over time all of the bacteria should become extinct. B) In any population, variation exists. Some bacteria are resistant to antibiotics. Most bacteria die, but the bacteria that are resistant survive and reproduce. C) In a population of bacteria that are exposed to antibiotics, some bacteria change their genetic make-up and survive. The new genetic make-up is passed on to offspring. D) There is a change in the environment: an antibiotic is added. Some of the bacteria are capable of changing to the new environment. They survive and reproduce, passing along their favorable traits.
Which best describes the nature of cellular respiration?
A student did an experiment with two identical plants, Plant 1 and Plant 2. About 10 mL fertilizer was added to Plant 1. About 200 mL of water was added to each plant every day. The height of the plants was recorded over a period of 5 weeks in the table shown below.Week Height of Plant 1 (in inches) Height of Plant 2 (in inches) 1 12.6 12.6 2 13.8 12.9 3 14.9 13.4 4 15.7 13.8 5 16.6 14.6 Based on the table, which of these conclusions is correct? Fertilizer helps plants grow taller. Fertilizer can help a plant survive for five days. Plants need more than 10 mL fertilizer to grow in size. I choose A is it right?
In exocytosis, the membrane package fuses with _____. the nucleus the cell membrane a transport protein a gap junction

Which of the following statements about mitosis and meiosis is *NOT* true?The cells resulting from meiosis are diploid and the cells resulting from mitosis are haploid.


Meiosis and meiosis both starts with one cell, meiosis ends with four and mitosis with two.


Mitosis produces new cells for growth and repair, meiosis produces gametes.


Mitosis goes through cytokinesis once, meiosis goes through cytokinesis twice.


Cross over happens in meiosis, but not in mitosis.

Answers

Cross over happens in meiosis, but not in mitosis.

Cross over happens in meiosis, but not in mitosis Mitosis makes genetically identical copies; meiosis does not

Genes that control feather color in some animals are expressed differently in the winter than in the summer. How might such a difference be beneficial to the ptarmigan bird?

Answers

The relationship of the genes and the chances for survival for the ptarmigan bird n is that the genes allow it to have two colours of feathers: white in the winter and brown in the summer.

This means that the bird will be less visible to predators in the winter, as it can hide in snow but also less visible to predators in the summer, as it can hide in grass!

As a result, more individuals will escape the predators and the species is more likely to survive.

Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11

Which organism provides energy to all other organisms in this ecosystem? A. prairie dog B. prairie grass C. vulture D. coyote

Answers

The prairie grass in this ecosystem is the primary producer, which stores most of the energy in this ecosystem to provide this energy to all other organisms, hence option B is correct.

What is a prairie ecosystem?

In this ecosystem, there is a continuous flow of energy due to the interaction of the biotic and abiotic factors, this ecosystem includes prairie dogs, coyotes, vultures, and prairie grass.

The primary producer of this ecosystem prairie grass is an autotroph by using the process of photosynthesis, they used make their own food having more amount of energy other than any tropic level.

All the organism in the ecosystem depends on the primary producer for their energy need, so indirectly on the sun.

Therefore, prairie grass in this ecosystem provides energy to all other organisms in this ecosystem.

Learn more about the ecosystem, here:

brainly.com/question/19594431

#SPJ3

B. Prairie Grass because it provides energy to all organisms in this ecosystem.

An interaction in which one organism captures and feeds on another organism is called

Answers

An interaction in which one organism captures and feeds on another organism is called predation.

An important characteristic of urine is its specific gravity or density, which is ________.A. 1.041-1.073
B. 1.001-1.035
C. 1.030-1.040
D. 1.000-1.015

Answers

An important characteristic of urine is its specific gravity or density, which is 1.001-1.035.