ASAPPPPP PLEASEE HELP ( WRONG ANSWRS WERE D ABD B) 10 POINTSSSS
Answers
Answer:
coal
Explanation:
Coal. Florida does not have any coal reserves or production and relies on coal from several other states and from overseas to meet its limited coal demand.
Hopes this help
Related Questions
1. How many different phenotypes are possible in the offspring of two parents with genotypes AA and aa, where A is the dominant allele for a trait and a is the recessive allele for the same trait? onetwo three four 2. A woman buys red-flowering and blue-flowering plants of the same species and plants them in her garden. The plant undergoes both self-fertilization and cross-fertilization. The woman collects seeds and plants them the following spring. What can the woman expect to observe in the flowers of the new generation of plants if the gene for flower color is codominant? (1 point) plants with red flowers and plants with blue flowers plants with both red and blue flowers plants with red flowers, plants with blue flowers, and plants with purple flowers plants with purple flowers 3. What is formed at the end of meiosis? two genetically identical cells four genetically different cells four genetically identical cells two genetically different cells 4. Which of the following is true concerning DNA replication? The original DNA molecule remains intact, although it acts as a template for the formation of a copy that contains two new antiparallel strands. The leading strand is copied in the 5’ to 3’ direction and the lagging strand is copied in the 3’ to 5’ direction. Both strands are copied to form Okazaki fragments, which are later annealed by DNA ligase. The replication process proceeds on both strands in the same direction, which requires that RNA primers bind to the lagging strand. 5. Which of the following will be directly affected in a bacterial cell that has a mutation in its gene for RNA polymerase? Which of the following will be directly affected in a bacterial cell that has a mutation in its gene for RNA polymerase? transcription translation gene regulation
The food for dicot embryos is stored in the while food for monocot embryos is stored in the .
Carol is enjoying eating her dinner. While eating, she notices that her saliva secretion is higher than normal and that she feels good and relaxed. What causes this relaxed state?
What system includes the core, mantle, and crust of the Earth?
b. construction.
c. technology.
d. all of the above.
Answers
When at first thought, it would seem that it is erosion. Erosion not only eliminates the soil minerals, it also washes everything else and that includes the soil. In a different manner, Leaching can happen when certain minute particles of the minerals are melted and mixes with water. All that is left in the soil will be the bigger particles that are not soluble by water. In this manner, only a soil that cannot properly nourish remains as it is stripped off of minerals.
Answer:
it would be D. All the above hope this helps :)
Explanation:
Answers
Answer:
poems and flower petals
Explanation:
Answers
Answer:
During interphase, the cell grows and the nuclear DNA is duplicated. Interphase is followed by the mitotic phase.
During interphase the cell grows and the nuclear DNA is duplicated. Interphase is followed by the mitotic phase, the duplicated chromosomes are segregated and distributed into daughter nuclei. The cytoplasm is usually divided as well resulting in two daughter cells
Answers
Answer:
The correct answer would be c. pupil.
Pupil refers to the adjustable opening present at the center of the iris.
It appears as a black hole present at the center of the eye through which light is passed into the eye.
The iris is muscular and contractile structure present around the pupil.
The pupil regulates or controls the amount of light entering the eye with the help of iris.
Iris through its contractile nature regulates the size of the pupil and thus, it controls the amount the light passing through the eye.
Final answer:
The adjustable opening in the center of the eye controlling light entry is the pupil, with size adjustments regulated by the iris.
Explanation:
The adjustable opening in the center of the eye that helps control the amount of light entering the eye is called the pupil. This integral part of the eye widens or narrows to allow more or less light to enter, respectively. The pupil's size is regulated by the surrounding muscle structure, the iris, which adjusts depending on the intensity of light present. Unlike the cornea and fovea, which have different roles, the pupil specifically controls light entrance.
Learn more about Pupil here:
#SPJ6
Answers
The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.
An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:
A Chain (21 amino acids):
GIVEQCCTSICSLYQLENYCN
B Chain (30 amino acids):
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).
Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.
Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.
Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.
Learn more about amino acids:
Final answer:
Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.
Explanation:
The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.
The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.
Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.
Learn more about Human Insulin here:
#SPJ11