BIOLOGY HIGH SCHOOL

The cell cycle results in the production of ______. four diploid cells, each with the same amount of genetic material and the same genetic information two diploid cells, each with the same amount of genetic material but with different genetic information two diploid cells, each with the same amount of genetic material and the same genetic information a diploid zygote four haploid cells, each with the same amount of genetic material but with different genetic information

Answers

Answer 1
Answer:

Answer:

The cell cycle results in the production of  two diploid cells, each with the same amount of genetic material and the same genetic information.

Related Questions

1. Which of the following occurs prior to speciation? A) Organisms of different populations join together. B) Different species share the same space. C) A population is divided. D) A major change on earth takes place. 2. Which of the following must be true of their individuals if two populations are no longer the same species? A) They do not have any of the same genes. B) They do not share any of the same space. C) They do not resemble each other at all. D) They cannot reproduce successfully with each other. 3. How does speciation start to take place on a genetic level between two isolated populations? A) Large numbers of mutations occur. B) Allele frequencies change in different ways. C) New genes are added to one group. D) Recessive alleles become dominant.
The Celsius temperature scale is also something called the centigrade scale. Why is this?
The skeleton that donald johanson discovered and named lucy bleonged to the ealest homind group called? a.neanderthals b.homo habilis c.australopithecines d.homo erectus
Aflatoxin is:_________a) the loss of an amino group on a nitrogenous base. b) the gain of an amino group on a nitrogenous base. c) an artificial mutagen. d) another name for unmethylated cytosine. e) a natural mutagen.
Which best describes fertilization and meiosis in the life cycle of plants

The most accepted theory regarding the make-up of living things is the _____. organismal theory cell theory chromosomal theory

Answers

Answer;

-Cell theory

The most accepted theory regarding the make-up of living things is the cell theory.

Explanation;

-Cell theory is a theory that includes one or both of the statements that the cell is the fundamental structural and functional unit of living matter and that the organism is composed of autonomous cells with its properties being the sum of those of its cells.

-According to cell theory; All living beings are made up of cells. Cell is the most basic unit of life. All cells must come from pre-existing cells.

-Cells are autonomous, in that they can acquire and use nutrients to obtain energy and they can reproduce. Simple organisms like bacteria are unicellular and composed of a single cell.
The most accepted theory is the Cell theory.

Which characteristic proves Lactobacillus acidophilus is from the specific kingdom Eubacteria?

Answers

The characteristic that proves Lactobacillus acidophilus is from the specific kingdom Eubacteria because it is a beneficial bacteria. It is usually used in fermentating yogurt and and sauerkraut. 

Answer:

The characteristic that proves Lactobacillus acidophilus is from the specific kingdom Eubacteria because it is a beneficial bacteria.

Explanation:

Which of the following organisms evolved from dinosaurs?A. birds
B. crocodiles
C. sharks
D. snakes

Answers

I guess I would say crocs. Their used to be water dinos like them called mosa that couldnt go on land. Todays modern version crocs can.

What is the density of the marble? A. 0.10 g/mL B. 240 g/mL C. 40 g/mL D. 1.875 g/mL

Answers

40 g/mL IS THE ANSWER

Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11

Compared with the walls of arteries, the walls of capillaries.A. are thicker
B. are thinner
C. lack valves
D. have more resistance

Answers

The correct answer is B. are thinner.

Compared with the walls of the arteries are thinner than the walls of the capillaries.
Capillary is termed as a small blood vessel which is from five to ten micrometers. They are known to be the smallest blood vessels in the body. 

They do convey blood between venules and arterioles. Substances which exits from capillaries include glucose, water, and oxygen. In embryonic development, new capillaries are formed through vasculogenesis.
The artery is termed as the blood vessel which takes away blood from the heart to the other parts of the body. Many arteries carry oxygenated blood except umbilical arteries and pulmonary artery which carries deoxygenated blood. Arteries are responsible to deliver nutrients and oxygen to all cells as well as they remove carbon dioxide and waste products.
Compared with the walls of arteries, the walls of capillaries B. are thinner. Due to definitions of both arteries and capillaries.
Other Questions
A bad case of tonsillitis can sometimes affect a person’s breathing. How is this possible? Support your claim and explain your reasoning.
Choose the phrase that best describes Jimmy Carter.A. dishonest Georgia governorB. old-school politicianC. Washington insiderD. Washington outsider
is the following sentence true or false? infared radiation in sunlight is absorbed by ozone before it reaches Earth
answer plzzzWhich statement is true about all perspectives of psychology? A.They study people, not animals. B.They are based on science. C.They focus on the actions of the brain's nerves. D.They focus on the mental well-being of individuals