A parallel DC circuit has a total current of 4 Amperes and a resistance of .5 Ohms. If the current is doubled, and the resistance is halved, how many times more is the new power compared to the old power?

Answers

Answer 1
Answer: The answer is 2 times.

In parallel DC circuit the power (P) can be calculated by using the values of total current (I) and resistance (R):
P = I²R

The old power is:
Po = Io² x Ro
Io = 4 A
Ro = 0.5 ohms (Ω)
So,Po = 4² A x 0.5 Ω = 8 W

The new power is:
Pn = In² x Rn
In = 4 A x 2 = 8 A
Rn = 0.5 Ω ÷ 2 = 0.25 Ω
So, Po = 8² A x 0.25 Ω = 16 W

Pn ÷ Po = 16 W ÷ 8 W = 2
Thus, the new power is 2 x higher than the old power.

Related Questions

From simplest to most complex the four levels of organization of the human body area. tissues, cells, organs and organ systems. b. cells, tissues, organs and organ systems. c. organ systems, tissues, cells and organs. d. cells, organs, tissues and organ systems
What must occur to a shopping cart at rest in order to make it roll forward?A) A force must be provided to overcome gravity. B) Balanced forces must be acting upon the cart. C) An unbalanced force applied to the cart pushing or pulling it forward. D) The unbalanced force acting upon it must be smaller than that of friction.
Most _____are crops like corn, goldenrod, or clover.hydrophytes mesophytes xerophytes
Actions that are reactions to a stimulus are called _____________________.
Choose the correct answer. -lactose is Glcα1-4Glc -maltose is Glcα1-4Glc -sucrose is Glcα1-2Glc -cellobiose is Galβ1-4Glc

Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11

What element has fewer valence electrons than magnesium

Answers

Any element in the first column of the periodic table. Hydrogen, lithium, sodium, and potassium are a few examples

What type of protein plays an important role in transmitting signals and to the nervous system

Answers

 ion channel membrane proteins 
I hope this helps;)

Round seeds and yellow seed color are dominant to wrinkled seeds and green seed color. What is the probability of having offspring that have wrinkled seeds and yellow seed color for the cross RRYY ´ RrYy?

Answers

The answer is 0 percent.

Let's represent alleles and genotypes:
R - dominant allele for round seeds,
r - recessive allele for wrinkled seeds,
Y - dominant allele for yellow seeds,
y - recessive allele for green seeds.

RR - dominant homozygote with round seeds,
rr - recessive homozygote with wrinkled seeds,
Rr- heterozygote with round seeds,
YY - dominant homozygote with yellow seeds,
yy - recessive homozygote with green seeds,
Yy * heterozygote with yellow seeds.

So, in order to have wrinkled seeds, the offspring's genotype must contain rr, and to have green seeds, the offspring's genotype must contain either YY or Yy.
According to the image, all of the offspring will have round, yellow seeds (RRYY, RRYy, RrYY, RrYy).

If RRYY and RrYy is crossed the probability of the offspring having wrinkled and yellow seed is none (zero).

Further Explanation:

Dominant character is the trait that masks the effect of the other character and is phenotypically shown. Whereas, the characters which is been masked is referred to be as recessive character.

In the given case,

• R- Denotes the dominant round seed character.

• r- Represents wrinkled recessive character.

• Y- Shows the dominant character of yellow colored seeds.

• y- Is used to represent the green color recessive trait.

Mentioned below are the possible homo and hetrozygotes of the trait;

 YY – Dominant homozygote which represents the yellow seeds.

 yy – Recessive homozygote representing green color seed.

 Yy – Dominant hetrozygote that represents yellow seeds.  

 RR – Dominant homozygote representing round seeds.

 Rr – Dominant hetrozygote representing round seeds.

 rr – Recessive homozygote representing wrinkled seeds.

In the given instance for the offspring to have wrinkled and yellow seed it should have the genotype of rrYy or rrYY.  

If the cross of RRYY and RrYy is done as shown in the punnett square; the required condition is not possible.

Learn more:

1. Learn more about meiosis brainly.com/question/1600165

2. Learn more about the process of molecular diffusion in a cell brainly.com/question/1600165

3. Learn more about human sperm and egg cell brainly.com/question/1626319

Answer Details:

Grade: High School

Subject: Biology

Chapter: Genetics- Mendalian Inheritance

Keywords:

RRYY, RrYy, round seeds, wrinkled seeds, yellow seeds, green seeds, Mendel, heterozygotes, homozygotes, dominant, recessive.

Which type of star cluster forms from tightly packed groups of older stars?

Answers

Answer:

The correct answer is option C which is globular. And the correct statement is:

Globular star cluster forms from tightly packed groups of older stars.

Explanation to the answer:

  • In the galaxies, stars are clustered in different patterns making different types of groups in the galaxies which can be recognized.
  • There are one type of clusters which are spherical in shape and tightly packed due to gravity and they also move around the satellites. These clusters are known as globular star clusters.
  • Hence option C is correct one.

The type of star cluster that forms from tightly packed group of older stars is called “The Globular cluster.”

Globular cluster is known to contain large group of old stars that are tightly and closely packed accordingly in a symmetrical but spherical form.

Further Explanation

Globular clusters are the largest and most enormous star clusters, and are known to usually appear in roughly spherical forms.  

Globular clusters are usually formed through molecules of giant cloud, or enormous masses of gas that form stars due to their collapse. Notably, globular clusters cannot form today as a result of the current limited availability of free gas compared to its abundance at the early stage of the universe.  

Globular clusters are found to be the oldest objects existing in the Galaxy. Globular clusters are said to contain between hundreds of thousands and millions of stars, and are heavily distinguished among other clusters due to their old age uniformity.  

The relative ages of elements in globular clusters ranges from 11 billion to 13 billion years after being determined by comparing stellar population of globular clusters with stellar evolutionary models.  

It should be noted that they could be as young as 9 billion years old based on modern developed research models.  

LEARN MORE:

KEYWORDS:

  • globular clusters
  • star cluster
  • free gas
  • stars
  • galaxy

Sustainable use of water as a natural resource in your community

Answers

Water is a limited natural resource, vital for the expansion and development of, not only our specie, but each individual living organism in the planet. Hence, in a community proper water management is a must in order to make sure that water be maintained and cared for -used wisely. In one research, it is estimated that by 2025 more places will feel water scarcity than decades ago.